SCOPe 2.08: Domain d6peba2: 6peb A:164-484

Lineage for d6peba2 (6peb A:164-484)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families)
   incomplete beta/alpha barrel with parallel beta-sheet of 7 strands

5. Family c.1.17.2: Nicotinate phosphoribosyltransferase C-terminal domain-like [110910] (2 proteins)
   automatically mapped to Pfam PF04095

6. Protein automated matches [419237] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [419806] (63 PDB entries)

8. Domain d6peba2: 6peb A:164-484 [416422]
   Other proteins in same PDB: d6peba1, d6pebb1, d6pebc1, d6pebd1
   automated match to d2h3ba2
   complexed with oe4, po4

Details for d6peba2

PDB Entry: 6peb, 2.46 Å

PDB Description: crystal structure of human nampt in complex with nvp-ltm976

PDB Compounds: (A:) Nicotinamide phosphoribosyltransferase

SCOPe Domain Sequences for d6peba2:

Sequence; same for both SEQRES and ATOM records:

>d6peba2 c.1.17.2 (A:164-484) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nsreqkkilakylletsgnldgleyklhdfgyrgvssqetagigasahlvnfkgtdtvag
lalikkyygtkdpvpgysvpaaehstitawgkdhekdafehivtqfssvpvsvvsdsydi
ynacekiwgedlrhlivsrstqapliirpdsgnpldtvlkvleilgkkfpvtenskgykl
lppylrviqgdgvdintlqeivegmkqkmwsieniafgsgggllqkltrdllncsfkcsy
vvtnglginvfkdpvadpnkrskkgrlslhrtpagnfvtleegkgdleeygqdllhtvfk
ngkvtksysfdeirknaqlni

Timeline for d6peba2:

• d6peba2 is new in SCOPe 2.08-stable