![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Twitchin, kinase domain [56126] (2 species) CaMK group; CAMKI subfamily; serine/threonine kinase |
![]() | Species California sea hare (Aplysia californica), twk43 [TaxId:6500] [56127] (1 PDB entry) |
![]() | Domain d1koba_: 1kob A: [41640] complexed with val |
PDB Entry: 1kob (more details), 2.3 Å
SCOPe Domain Sequences for d1koba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} indydkfyediwkkyvpqpvevkqgsvydyydileelgsgafgvvhrcvekatgrvfvak fintpypldkytvkneisimnqlhhpklinlhdafedkyemvlileflsggelfdriaae dykmseaevinymrqaceglkhmhehsivhldikpenimcetkkassvkiidfglatkln pdeivkvttataefaapeivdrepvgfytdmwaigvlgyvllsglspfageddletlqnv krcdwefdedafssvspeakdfiknllqkeprkrltvhdalehpwlkgdhsnltsripss rynkirqkikekyadwpapqpaigrianfsslrkhrpqeyqiydsyfdrkea
Timeline for d1koba_: