SCOPe 2.08: Domain d6nhkb2: 6nhk B:238-429

Lineage for d6nhkb2 (6nhk B:238-429)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224896] (72 PDB entries)

8. Domain d6nhkb2: 6nhk B:238-429 [416393]
   automated match to d6gfaa2
   complexed with adp, gol, mg, po4

Details for d6nhkb2

PDB Entry: 6nhk, 2.78 Å

PDB Description: mortalin nucleotide binding domain in the adp-bound state

PDB Compounds: (B:) Stress-70 protein, mitochondrial

SCOPe Domain Sequences for d6nhkb2:

Sequence; same for both SEQRES and ATOM records:

>d6nhkb2 c.55.1.0 (B:238-429) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kviavydlgggtfdisileiqkgvfevkstngdtflggedfdqallrhivkefkretgvd
ltkdnmalqrvreaaekakcelsssvqtdinlpyltmdssgpkhlnmkltraqfegivtd
lirrtiapcqkamqdaevsksdigevilvggmtrmpkvqqtvqdlfgrapskavnpdeav
aigaaiqggvla

Timeline for d6nhkb2:

• d6nhkb2 is new in SCOPe 2.08-stable