![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein gamma-subunit of glycogen phosphorylase kinase (Phk) [56122] (1 species) CaMK group; CAMKI subfamily; serine/threonine kinase |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [56123] (3 PDB entries) |
![]() | Domain d2phka_: 2phk A: [41637] complexed with atp, gol, mn |
PDB Entry: 2phk (more details), 2.6 Å
SCOP Domain Sequences for d2phka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} gfyenyepkeilgrgvssvvrrcihkptckeyavkiidvtgggsfsaeevqelreatlke vdilrkvsghpniiqlkdtyetntffflvfdlmkkgelfdyltekvtlseketrkimral levicalhklnivhrdlkpenilldddmnikltdfgfscqldpgeklrevcgtpsylape iiecsmndnhpgygkevdmwstgvimytllagsppfwhrkqmlmlrmimsgnyqfgspew ddysdtvkdlvsrflvvqpqkrytaeealahpffqqy
Timeline for d2phka_: