Lineage for d1ql6a_ (1ql6 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1930509Protein gamma-subunit of glycogen phosphorylase kinase (Phk) [56122] (1 species)
    CaMK group; CAMKI subfamily; serine/threonine kinase
  7. 1930510Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [56123] (3 PDB entries)
  8. 1930512Domain d1ql6a_: 1ql6 A: [41636]
    complexed with atp, mn, so4; mutant

Details for d1ql6a_

PDB Entry: 1ql6 (more details), 2.4 Å

PDB Description: the catalytic mechanism of phosphorylase kinase probed by mutational studies
PDB Compounds: (A:) phosphorylase kinase

SCOPe Domain Sequences for d1ql6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ql6a_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
sthgfyenyepkeilgrgvssvvrrcihkptckeyavkiidvtgggsfsaeevqelreat
lkevdilrkvsghpniiqlkdtyetntffflvfdlmkkgelfdyltekvtlseketrkim
rallevicalhklnivhrdlkpenilldddmnikltdfgfscqldpgeklrsvcgtpsyl
apeiiecsmndnhpgygkevdmwstgvimytllagsppfwhrkqmlmlrmimsgnyqfgs
pewddysdtvkdlvsrflvvqpqkrytaeealahpffqqyv

SCOPe Domain Coordinates for d1ql6a_:

Click to download the PDB-style file with coordinates for d1ql6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ql6a_: