Lineage for d1ql6a_ (1ql6 A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36268Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 36269Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) (S)
  5. 36270Family d.144.1.1: Serine/threonin kinases [56113] (15 proteins)
  6. 36333Protein gamma-subunit of glycogen phosphorylase kinase (Phk) [56122] (1 species)
  7. 36334Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [56123] (3 PDB entries)
  8. 36336Domain d1ql6a_: 1ql6 A: [41636]

Details for d1ql6a_

PDB Entry: 1ql6 (more details), 2.4 Å

PDB Description: the catalytic mechanism of phosphorylase kinase probed by mutational studies

SCOP Domain Sequences for d1ql6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ql6a_ d.144.1.1 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus)}
sthgfyenyepkeilgrgvssvvrrcihkptckeyavkiidvtgggsfsaeevqelreat
lkevdilrkvsghpniiqlkdtyetntffflvfdlmkkgelfdyltekvtlseketrkim
rallevicalhklnivhrdlkpenilldddmnikltdfgfscqldpgeklrsvcgtpsyl
apeiiecsmndnhpgygkevdmwstgvimytllagsppfwhrkqmlmlrmimsgnyqfgs
pewddysdtvkdlvsrflvvqpqkrytaeealahpffqqyv

SCOP Domain Coordinates for d1ql6a_:

Click to download the PDB-style file with coordinates for d1ql6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ql6a_: