Lineage for d1a06__ (1a06 -)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138043Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 138044Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 138045Family d.144.1.1: Serine/threonin kinases [56113] (17 proteins)
  6. 138049Protein Calmodulin-dependent protein kinase [56120] (1 species)
  7. 138050Species Rat (Rattus norvegicus) [TaxId:10116] [56121] (1 PDB entry)
  8. 138051Domain d1a06__: 1a06 - [41634]

Details for d1a06__

PDB Entry: 1a06 (more details), 2.5 Å

PDB Description: calmodulin-dependent protein kinase from rat

SCOP Domain Sequences for d1a06__:

Sequence, based on SEQRES records: (download)

>d1a06__ d.144.1.1 (-) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus)}
wkqaedirdiydfrdvlgtgafsevilaedkrtqklvaikciakkalegkegsmeneiav
lhkikhpnivalddiyesgghlylimqlvsggelfdrivekgfyterdasrlifqvldav
kylhdlgivhrdlkpenllyysldedskimisdfglskmedpgsvlstacgtpgyvapev
laqkpyskavdcwsigviayillcgyppfydendaklfeqilkaeyefdspywddisdsa
kdfirhlmekdpekrftceqalqhpwiagdtaldknihqsvseqikknfakskwkqafna
tavvrhm

Sequence, based on observed residues (ATOM records): (download)

>d1a06__ d.144.1.1 (-) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus)}
wkqaedirdiydfrdvlgtgafsevilaedkrtqklvaikciakeneiavlhkikhpniv
alddiyesgghlylimqlvsggelfdrivekgfyterdasrlifqvldavkylhdlgivh
rdlkpenllyysldedskimisdfpgyvapevlaqkpyskavdcwsigviayillcgypp
fydendaklfeqilkaeyefdspywddisdsakdfirhlmekdpekrftceqalqhpwia
gdtaldknihqsvseqikknfakskwkqafnatavvrhm

SCOP Domain Coordinates for d1a06__:

Click to download the PDB-style file with coordinates for d1a06__.
(The format of our PDB-style files is described here.)

Timeline for d1a06__: