SCOPe 2.08: Domain d6l46a2: 6l46 A:167-315

Lineage for d6l46a2 (6l46 A:167-315)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (31 species)
   not a true protein

7. Species Geobacillus thermodenitrificans [TaxId:33940] [419991] (4 PDB entries)

8. Domain d6l46a2: 6l46 A:167-315 [416315]
   automated match to d6thea2
   complexed with cl, cu, dod, mpd, na

Details for d6l46a2

PDB Entry: 6l46, 1.3 Å

PDB Description: high-resolution neutron and x-ray joint refined structure of copper- containing nitrite reductase from geobacillus thermodenitrificans

PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d6l46a2:

Sequence; same for both SEQRES and ATOM records:

>d6l46a2 b.6.1.0 (A:167-315) automated matches {Geobacillus thermodenitrificans [TaxId: 33940]}
dreyvliqnewykyndmndfqngvpsyvvfsskalkpgdpntngdtftlkekpllakvge
kirlyinnvgpnevssfhvvgtvfddvyldgnpnnhlqgmqtvmlpasggavveftvtrp
gtypivthqfnhaqkgavamlkvtetged

Timeline for d6l46a2:

• d6l46a2 is new in SCOPe 2.08-stable