Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
Protein automated matches [190988] (51 species) not a true protein |
Species Human norovirus - alphatron [TaxId:106516] [420024] (4 PDB entries) |
Domain d6jyrc_: 6jyr C: [416277] automated match to d5or7a_ complexed with gol |
PDB Entry: 6jyr (more details), 1.5 Å
SCOPe Domain Sequences for d6jyrc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jyrc_ b.121.4.0 (C:) automated matches {Human norovirus - alphatron [TaxId: 106516]} tksftlpiltisemtnsrfpipieqlytapnetnvvqcqngrctldgelqgttqllssai csyrgrtlanndswdqnllqlsypngasydptdevpaplgtqdfsgilygvltqdnvteg tgeaknakgiyisttsgkftpkigsiglhsitgdvhhnqqsrftpvgiavnentpfkqwv lphysgslalntnlapavaptfpgeqllffrsrvpcvqglhgqdafidcllpqewvnhfy qeaapsqtdvalirfvnpdtgrtlfeaklhrsgfitvshtgnyplvippnghfrfdswvn qfyslapm
Timeline for d6jyrc_: