Lineage for d6jyrc_ (6jyr C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2822534Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2822535Protein automated matches [190988] (51 species)
    not a true protein
  7. 2822673Species Human norovirus - alphatron [TaxId:106516] [420024] (4 PDB entries)
  8. 2822688Domain d6jyrc_: 6jyr C: [416277]
    automated match to d5or7a_
    complexed with gol

Details for d6jyrc_

PDB Entry: 6jyr (more details), 1.5 Å

PDB Description: gii.13/21 noroviruses recognize glycans with a terminal beta-galactose via an unconventional glycan binding site
PDB Compounds: (C:) norovirus P domain protein

SCOPe Domain Sequences for d6jyrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jyrc_ b.121.4.0 (C:) automated matches {Human norovirus - alphatron [TaxId: 106516]}
tksftlpiltisemtnsrfpipieqlytapnetnvvqcqngrctldgelqgttqllssai
csyrgrtlanndswdqnllqlsypngasydptdevpaplgtqdfsgilygvltqdnvteg
tgeaknakgiyisttsgkftpkigsiglhsitgdvhhnqqsrftpvgiavnentpfkqwv
lphysgslalntnlapavaptfpgeqllffrsrvpcvqglhgqdafidcllpqewvnhfy
qeaapsqtdvalirfvnpdtgrtlfeaklhrsgfitvshtgnyplvippnghfrfdswvn
qfyslapm

SCOPe Domain Coordinates for d6jyrc_:

Click to download the PDB-style file with coordinates for d6jyrc_.
(The format of our PDB-style files is described here.)

Timeline for d6jyrc_:

  • d6jyrc_ is new in SCOPe 2.08-stable