SCOPe 2.08: Domain d6jqcb_: 6jqc B:

Lineage for d6jqcb_ (6jqc B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.53: Resolvase-like [53040] (2 superfamilies)
   Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families)

5. Family c.53.2.0: automated matches [191506] (1 protein)
   not a true family

6. Protein automated matches [190830] (15 species)
   not a true protein

7. Species Neosartorya fumigata [TaxId:330879] [401813] (7 PDB entries)

8. Domain d6jqcb_: 6jqc B: [416264]
   automated match to d6y04a_
   complexed with zn

Details for d6jqcb_

PDB Entry: 6jqc, 1.8 Å

PDB Description: the structural basis of the beta-carbonic anhydrase cafc (wild type) of the filamentous fungus aspergillus fumigatus

PDB Compounds: (B:) carbonic anhydrase

SCOPe Domain Sequences for d6jqcb_:

Sequence; same for both SEQRES and ATOM records:

>d6jqcb_ c.53.2.0 (B:) automated matches {Neosartorya fumigata [TaxId: 330879]}
mtnvadieaanaqyaaaftkghlplppkrklavvtcmdaridvfsvlgltegdahvirna
ggrasealrsliisqrllgteevvvihhtdcgmltfsdedirakireelgedasdikflp
frdleasvredvrflrgsrlvqgnvtgyvyevergrlvrldvsd

Timeline for d6jqcb_:

• d6jqcb_ is new in SCOPe 2.08-stable