Lineage for d6jqca_ (6jqc A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883013Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2883078Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) (S)
  5. 2883196Family c.53.2.0: automated matches [191506] (1 protein)
    not a true family
  6. 2883197Protein automated matches [190830] (15 species)
    not a true protein
  7. 2883261Species Neosartorya fumigata [TaxId:330879] [401813] (7 PDB entries)
  8. 2883274Domain d6jqca_: 6jqc A: [416263]
    automated match to d6y04a_
    complexed with zn

Details for d6jqca_

PDB Entry: 6jqc (more details), 1.8 Å

PDB Description: the structural basis of the beta-carbonic anhydrase cafc (wild type) of the filamentous fungus aspergillus fumigatus
PDB Compounds: (A:) carbonic anhydrase

SCOPe Domain Sequences for d6jqca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jqca_ c.53.2.0 (A:) automated matches {Neosartorya fumigata [TaxId: 330879]}
mtnvadieaanaqyaaaftkghlplppkrklavvtcmdaridvfsvlgltegdahvirna
ggrasealrsliisqrllgteevvvihhtdcgmltfsdedirakireelgedasdikflp
frdleasvredvrflrgsrlvqgnvtgyvyevergrlvrldvsd

SCOPe Domain Coordinates for d6jqca_:

Click to download the PDB-style file with coordinates for d6jqca_.
(The format of our PDB-style files is described here.)

Timeline for d6jqca_:

  • d6jqca_ is new in SCOPe 2.08-stable