![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
![]() | Protein automated matches [190039] (161 species) not a true protein |
![]() | Species Thermus thermophilus [TaxId:300852] [420023] (34 PDB entries) |
![]() | Domain d6japa1: 6jap A:3-402 [416224] Other proteins in same PDB: d6japa2 automated match to d6dtqa_ complexed with cit, edo, fru, glc, gol; mutant |
PDB Entry: 6jap (more details), 1.77 Å
SCOPe Domain Sequences for d6japa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6japa1 c.94.1.0 (A:3-402) automated matches {Thermus thermophilus [TaxId: 300852]} gpvirvagdstavgeggrwmkemveawgkktgtrveyidspadtndrlalyqqywaarsp dvdvymidviwpgivaphaldlkpylteaelkeffprivqnntirgkltslpfftdagil yyrkdllekygytspprtwneleqmaervmegerragnrdfwgfvfqgkpyegltcdale wiyshgggrivepdgtisvnngraalalnrahgwvgriapqgvtsyaeeearnvwqqgns lfmrnwpyayalgqaegspirgkfgvtvlpkasadapnaatlggwqlmvsaysrypkeav dlvkylasyevqkdnavrlsrlptrpalytdrdvlarnpwfrdllpvfqnavsapsdvag arynqvseaiwtevhsvltgrkkgeqavrdlearirrilr
Timeline for d6japa1: