Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein cAMP-dependent PK, catalytic subunit [56116] (4 species) AGC group; PKA subfamily; serine/threonine kinase |
Species Pig (Sus scrofa) [TaxId:9823] [56117] (9 PDB entries) |
Domain d1cdkb_: 1cdk B: [41621] complexed with anp, mn, myr |
PDB Entry: 1cdk (more details), 2 Å
SCOPe Domain Sequences for d1cdkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cdkb_ d.144.1.7 (B:) cAMP-dependent PK, catalytic subunit {Pig (Sus scrofa) [TaxId: 9823]} kgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhketgn hfamkildkqkvvklkqiehtlnekrilqavnfpflvkleysfkdnsnlymvmeyvpgge mfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgf akrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiy ekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkdgvndiknhkwfattdwiaiyq rkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
Timeline for d1cdkb_: