Lineage for d6izqa_ (6izq A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2892965Family c.66.1.6: Arginine methyltransferase [53351] (5 proteins)
    lacks the last two strands of the common fold replaced with a beta-sandwich oligomerisation subdomain
  6. 2892996Protein automated matches [254715] (3 species)
    not a true protein
  7. 2892997Species Human (Homo sapiens) [TaxId:9606] [313441] (18 PDB entries)
  8. 2893047Domain d6izqa_: 6izq A: [416200]
    automated match to d2v7ea_
    complexed with xj2

Details for d6izqa_

PDB Entry: 6izq (more details), 2.45 Å

PDB Description: prmt4 bound with a bicyclic compound
PDB Compounds: (A:) histone-arginine methyltransferase carm1

SCOPe Domain Sequences for d6izqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6izqa_ c.66.1.6 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
savqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkdkivldvgcgsgilsffaaq
agarkiyaveastmaqhaevlvksnnltdrivvipgkveevslpeqvdiiisepmgymlf
nermlesylhakkylkpsgnmfptigdvhlapftdeqlymeqftkanfwyqpsfhgvdls
alrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakegdlhrieipfkfhmlhsglv
hglafwfdvafigsimtvwlstapteplthwyqvrclfqsplfakagdtlsgtclliank
rqsydisivaqvdqtgskssnlldlknpffry

SCOPe Domain Coordinates for d6izqa_:

Click to download the PDB-style file with coordinates for d6izqa_.
(The format of our PDB-style files is described here.)

Timeline for d6izqa_:

  • d6izqa_ is new in SCOPe 2.08-stable