Lineage for d6iywf2 (6iyw F:252-405)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.160: L,D-transpeptidase catalytic domain-like [141522] (1 superfamily)
barrel, closed; n=8, S=10; one overside connectionSuperfamily b.160.1: L,D-transpeptidase catalytic domain-like [141523] (1 family) 
automatically mapped to Pfam PF03734Family b.160.1.1: L,D-transpeptidase catalytic domain-like [141524] (3 proteins)
Pfam PF03734; ErfK/YbiS/YcfS/YnhGProtein automated matches [234004] (6 species)
not a true protein
Species Mycobacterium tuberculosis [TaxId:83332] [419972] (10 PDB entries) 
Domain d6iywf2: 6iyw F:252-405 [416199]
Other proteins in same PDB: d6iywa1, d6iywb1, d6iywc1, d6iywd1, d6iywe1, d6iywf1
automated match to d3tura2
complexed with gol, im2
Details for d6iywf2
PDB Entry: 6iyw (more details), 1.6 Å
PDB Description: crystal sturucture of l,d-transpeptidase ldtmt2 from mycobacterium tuberculosis in complex with imipenem adduct
PDB Compounds: (F:) L,D-transpeptidase 2SCOPe Domain Sequences for d6iywf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6iywf2 b.160.1.1 (F:252-405) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
eviataddntkiltvrvngevvksmptsmgkdstptangiyivgsrykhiimdsstygvp
vnspngyrtdvdwatqisysgvfvhsapwsvgaqghtntshgclnvspsnaqwfydhvkr
gdivevvntvggtlpgidglgdwnipwdqwragn
SCOPe Domain Coordinates for d6iywf2:
Click to download the PDB-style file with coordinates for d6iywf2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6iywf2:
- d6iywf2 is new in SCOPe 2.08-stable
View in 3D
