Lineage for d6iywb1 (6iyw B:141-251)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766441Species Mycobacterium tuberculosis [TaxId:83332] [419971] (10 PDB entries)
  8. 2766458Domain d6iywb1: 6iyw B:141-251 [416190]
    Other proteins in same PDB: d6iywa2, d6iywb2, d6iywc2, d6iywd2, d6iywe2, d6iywf2
    automated match to d3tura1
    complexed with gol, im2

Details for d6iywb1

PDB Entry: 6iyw (more details), 1.6 Å

PDB Description: crystal sturucture of l,d-transpeptidase ldtmt2 from mycobacterium tuberculosis in complex with imipenem adduct
PDB Compounds: (B:) L,D-transpeptidase 2

SCOPe Domain Sequences for d6iywb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iywb1 b.1.18.0 (B:141-251) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ltfqtsspahltmpyvmpgdgevvgvgepvairfdeniadrgaaekaikittnppvegaf
ywlnnrevrwrpehfwkpgtavdvavntygvdlgegmfgednvqthftigd

SCOPe Domain Coordinates for d6iywb1:

Click to download the PDB-style file with coordinates for d6iywb1.
(The format of our PDB-style files is described here.)

Timeline for d6iywb1:

  • d6iywb1 is new in SCOPe 2.08-stable