Lineage for d6iywa2 (6iyw A:252-406)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825385Fold b.160: L,D-transpeptidase catalytic domain-like [141522] (1 superfamily)
    barrel, closed; n=8, S=10; one overside connection
  4. 2825386Superfamily b.160.1: L,D-transpeptidase catalytic domain-like [141523] (1 family) (S)
    automatically mapped to Pfam PF03734
  5. 2825387Family b.160.1.1: L,D-transpeptidase catalytic domain-like [141524] (3 proteins)
    Pfam PF03734; ErfK/YbiS/YcfS/YnhG
  6. 2825409Protein automated matches [234004] (6 species)
    not a true protein
  7. 2825441Species Mycobacterium tuberculosis [TaxId:83332] [419972] (10 PDB entries)
  8. 2825457Domain d6iywa2: 6iyw A:252-406 [416189]
    Other proteins in same PDB: d6iywa1, d6iywb1, d6iywc1, d6iywd1, d6iywe1, d6iywf1
    automated match to d3tura2
    complexed with gol, im2

Details for d6iywa2

PDB Entry: 6iyw (more details), 1.6 Å

PDB Description: crystal sturucture of l,d-transpeptidase ldtmt2 from mycobacterium tuberculosis in complex with imipenem adduct
PDB Compounds: (A:) L,D-transpeptidase 2

SCOPe Domain Sequences for d6iywa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iywa2 b.160.1.1 (A:252-406) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
eviataddntkiltvrvngevvksmptsmgkdstptangiyivgsrykhiimdsstygvp
vnspngyrtdvdwatqisysgvfvhsapwsvgaqghtntshgclnvspsnaqwfydhvkr
gdivevvntvggtlpgidglgdwnipwdqwragna

SCOPe Domain Coordinates for d6iywa2:

Click to download the PDB-style file with coordinates for d6iywa2.
(The format of our PDB-style files is described here.)

Timeline for d6iywa2:

  • d6iywa2 is new in SCOPe 2.08-stable