![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.67: Bestropin channel-like [418719] (1 superfamily) four transmembrane helices; forms pentameric pore channel |
![]() | Superfamily f.67.1: Bestropin channel-like [418750] (1 family) ![]() |
![]() | Family f.67.1.1: Bestropin channel-like [418819] (3 proteins) Pfam PF01062 |
![]() | Protein automated matches [419263] (3 species) not a true protein |
![]() | Species Klebsiella pneumoniae [TaxId:573] [419986] (8 PDB entries) |
![]() | Domain d6ivrc_: 6ivr C: [416181] automated match to d4wd7b_ complexed with acy, cl, edo, zn |
PDB Entry: 6ivr (more details), 2.8 Å
SCOPe Domain Sequences for d6ivrc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ivrc_ f.67.1.1 (C:) automated matches {Klebsiella pneumoniae [TaxId: 573]} kiifrlllnvlmsiiaiisyqwyeqlgihltvapfsllgiaiaiflgfrnsasysrfvea rnlwgtvliaertlvrqlrnilpaehdahrrivsylvafswslkhqlrktdptadlrrll peervteilassmptnrilllagneigqlreagklsdityglmdnkldelahvlggcerl attpvpfaytlilqrtvylfctllpfalvgdlhymtpfvsvfisytflswdslaeeledp fgtaandlplnamcntiernlldmtgqhp
Timeline for d6ivrc_:
![]() Domains from other chains: (mouse over for more information) d6ivra_, d6ivrb_, d6ivrd_, d6ivre_ |