| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.67: Bestropin channel-like [418719] (1 superfamily) four transmembrane helices; forms pentameric pore channel |
Superfamily f.67.1: Bestropin channel-like [418750] (1 family) ![]() |
| Family f.67.1.1: Bestropin channel-like [418819] (3 proteins) Pfam PF01062 |
| Protein automated matches [419263] (3 species) not a true protein |
| Species Klebsiella pneumoniae [TaxId:573] [419986] (8 PDB entries) |
| Domain d6ivod_: 6ivo D: [416172] automated match to d4wd7b_ complexed with acy, cl, edo, na, pg4, pge, zn |
PDB Entry: 6ivo (more details), 2.45 Å
SCOPe Domain Sequences for d6ivod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ivod_ f.67.1.1 (D:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
skiifrlllnvlmsiiaiisyqwyeqlgihltvapfsllgiaiaiflgfrnsasysrfve
arnlwgtvliaertlvrqlrnilpaehdahrrivsylvafswslkhqlrktdptadlrrl
lpeervteilassmptnrilllagneigqlreagklsdityglmdnkldelahvlggcer
lattpvafaytlilqrtvylfctllpfalvgdlhymtpfvsvfisytflswdslaeeled
pfgtaandlplnamcntiernlldmtgqhplpe
Timeline for d6ivod_:
View in 3DDomains from other chains: (mouse over for more information) d6ivoa_, d6ivob_, d6ivoc_, d6ivoe_ |