![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.67: Bestropin channel-like [418719] (1 superfamily) four transmembrane helices; forms pentameric pore channel |
![]() | Superfamily f.67.1: Bestropin channel-like [418750] (1 family) ![]() |
![]() | Family f.67.1.1: Bestropin channel-like [418819] (3 proteins) Pfam PF01062 |
![]() | Protein automated matches [419263] (3 species) not a true protein |
![]() | Species Klebsiella pneumoniae [TaxId:573] [419986] (8 PDB entries) |
![]() | Domain d6ivne_: 6ivn E: [416168] automated match to d4wd7b_ complexed with cl, glu, zn |
PDB Entry: 6ivn (more details), 3.1 Å
SCOPe Domain Sequences for d6ivne_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ivne_ f.67.1.1 (E:) automated matches {Klebsiella pneumoniae [TaxId: 573]} skiifrlllnvlmsiiaiisyqwyeqlgihltvapfsllgiaiaiflgfrnsasysrfve arnlwgtvliaertlvrqlrnilpaehdahrrivsylvafswslkhqlrktdptadlrrl lpeervteilassmptnrilllagneigqlreagklsdityglmdnkldelahvlggcer lattpvpfaytlilqrtvylfctllpfalvgdlhymtpfvsvfisytflswdslaeeled pfataandlplnamcntiernlldmtgqhplp
Timeline for d6ivne_:
![]() Domains from other chains: (mouse over for more information) d6ivna_, d6ivnb_, d6ivnc_, d6ivnd_ |