![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) ![]() |
![]() | Family d.144.1.1: Serine/threonin kinases [56113] (15 proteins) |
![]() | Protein Cyclin-dependent PK (CDK, different isozymes) [56114] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [56115] (20 PDB entries) |
![]() | Domain d1fvvc_: 1fvv C: [41616] Other proteins in same PDB: d1fvvb1, d1fvvb2, d1fvvd1, d1fvvd2 |
PDB Entry: 1fvv (more details), 2.8 Å
SCOP Domain Sequences for d1fvvc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fvvc_ d.144.1.1 (C:) Cyclin-dependent PK (CDK, different isozymes) {Human (Homo sapiens)} menfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh pnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchs hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlrl
Timeline for d1fvvc_: