Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.67: Bestropin channel-like [418719] (1 superfamily) four transmembrane helices; forms pentameric pore channel |
Superfamily f.67.1: Bestropin channel-like [418750] (1 family) |
Family f.67.1.1: Bestropin channel-like [418819] (3 proteins) Pfam PF01062 |
Protein automated matches [419263] (3 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [419986] (8 PDB entries) |
Domain d6ivkb_: 6ivk B: [416155] automated match to d4wd7b_ complexed with acy, cl, edo, pge, zn |
PDB Entry: 6ivk (more details), 2.65 Å
SCOPe Domain Sequences for d6ivkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ivkb_ f.67.1.1 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]} skiifrlllnvlmsiiaiisyqwyeqlgihltvapfsllgiaiaiflgfrnsasysrfve arnlwgtvliaertlvrqlrnilpaehdahrrivsylvafswslkhqlrktdptadlrrl lpeervteilassmptnrilllagneigqlreaaklsdityglmdnkldelahvlggcer lattpvpfaytlilqrtvylfctllpfalvgdlhymtpfvsvfisytflswdslaeeled pfgtaandlplnamcntiernlldmtgqhplp
Timeline for d6ivkb_:
View in 3D Domains from other chains: (mouse over for more information) d6ivka_, d6ivkc_, d6ivkd_, d6ivke_ |