Lineage for d6ivja_ (6ivj A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3029261Fold f.67: Bestropin channel-like [418719] (1 superfamily)
    four transmembrane helices; forms pentameric pore channel
  4. 3029262Superfamily f.67.1: Bestropin channel-like [418750] (1 family) (S)
  5. 3029263Family f.67.1.1: Bestropin channel-like [418819] (3 proteins)
    Pfam PF01062
  6. 3029303Protein automated matches [419263] (3 species)
    not a true protein
  7. 3029346Species Klebsiella pneumoniae [TaxId:573] [419986] (8 PDB entries)
  8. 3029362Domain d6ivja_: 6ivj A: [416149]
    automated match to d4wd7b_
    complexed with acy, cl, zn

Details for d6ivja_

PDB Entry: 6ivj (more details), 2.77 Å

PDB Description: crystal structure of a membrane protein g18a
PDB Compounds: (A:) Ibestrophin

SCOPe Domain Sequences for d6ivja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ivja_ f.67.1.1 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
lskiifrlllnvlmsiiaiisyqwyeqlgihltvapfsllgiaiaiflgfrnsasysrfv
earnlwgtvliaertlvrqlrnilpaehdahrrivsylvafswslkhqlrktdptadlrr
llpeervteilassmptnrilllagneigqlreagklsdityglmdnkldelahvlggce
rlattpvpfaytlilqrtvylfctllpfalvgdlhymtpfvsvfisytflswdslaeele
dpfgtaandlplnamcntiernlldmtgq

SCOPe Domain Coordinates for d6ivja_:

Click to download the PDB-style file with coordinates for d6ivja_.
(The format of our PDB-style files is described here.)

Timeline for d6ivja_:

  • d6ivja_ is new in SCOPe 2.08-stable