Lineage for d6iv4d_ (6iv4 D:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3029261Fold f.67: Bestropin channel-like [418719] (1 superfamily)
    four transmembrane helices; forms pentameric pore channel
  4. 3029262Superfamily f.67.1: Bestropin channel-like [418750] (1 family) (S)
  5. 3029263Family f.67.1.1: Bestropin channel-like [418819] (3 proteins)
    Pfam PF01062
  6. 3029303Protein automated matches [419263] (3 species)
    not a true protein
  7. 3029315Species Klebsiella pneumoniae [TaxId:1432554] [420021] (6 PDB entries)
  8. 3029344Domain d6iv4d_: 6iv4 D: [416147]
    automated match to d4wd7b_
    complexed with zn; mutant

Details for d6iv4d_

PDB Entry: 6iv4 (more details), 3.14 Å

PDB Description: crystal structure of a bacterial bestrophin homolog from klebsiella pneumoniae with a mutation w252f
PDB Compounds: (D:) Bestrophin homolog

SCOPe Domain Sequences for d6iv4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iv4d_ f.67.1.1 (D:) automated matches {Klebsiella pneumoniae [TaxId: 1432554]}
kiifrlllnvlmsiiaiisyqwyeqlgihltvapfsllgiaiaiflgfrnsasysrfvea
rnlwgtvliaertlvrqlrnilpaehdahrrivsylvafswslkhqlrktdptadlrrll
peervteilassmptnrilllagneigqlreagklsdityglmdnkldelahvlggcerl
attpvpfaytlilqrtvylfctllpfalvgdlhymtpfvsvfisytflsfdslaeeledp
fgtaandlplnamcntiernlldmtgq

SCOPe Domain Coordinates for d6iv4d_:

Click to download the PDB-style file with coordinates for d6iv4d_.
(The format of our PDB-style files is described here.)

Timeline for d6iv4d_:

  • d6iv4d_ is new in SCOPe 2.08-stable