Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.67: Bestropin channel-like [418719] (1 superfamily) four transmembrane helices; forms pentameric pore channel |
Superfamily f.67.1: Bestropin channel-like [418750] (1 family) |
Family f.67.1.1: Bestropin channel-like [418819] (3 proteins) Pfam PF01062 |
Protein automated matches [419263] (3 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:1432554] [420021] (6 PDB entries) |
Domain d6iv4d_: 6iv4 D: [416147] automated match to d4wd7b_ complexed with zn; mutant |
PDB Entry: 6iv4 (more details), 3.14 Å
SCOPe Domain Sequences for d6iv4d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6iv4d_ f.67.1.1 (D:) automated matches {Klebsiella pneumoniae [TaxId: 1432554]} kiifrlllnvlmsiiaiisyqwyeqlgihltvapfsllgiaiaiflgfrnsasysrfvea rnlwgtvliaertlvrqlrnilpaehdahrrivsylvafswslkhqlrktdptadlrrll peervteilassmptnrilllagneigqlreagklsdityglmdnkldelahvlggcerl attpvpfaytlilqrtvylfctllpfalvgdlhymtpfvsvfisytflsfdslaeeledp fgtaandlplnamcntiernlldmtgq
Timeline for d6iv4d_:
View in 3D Domains from other chains: (mouse over for more information) d6iv4a_, d6iv4b_, d6iv4c_, d6iv4e_ |