Lineage for d1g3ne_ (1g3n E:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2219260Protein Cyclin-dependent PK, CDK6 [88859] (1 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 2219261Species Human (Homo sapiens) [TaxId:9606] [88860] (14 PDB entries)
  8. 2219267Domain d1g3ne_: 1g3n E: [41614]
    Other proteins in same PDB: d1g3nb_, d1g3nc1, d1g3nc2, d1g3nf_, d1g3ng1, d1g3ng2

Details for d1g3ne_

PDB Entry: 1g3n (more details), 2.9 Å

PDB Description: structure of a p18(ink4c)-cdk6-k-cyclin ternary complex
PDB Compounds: (E:) cyclin-dependent kinase 6

SCOPe Domain Sequences for d1g3ne_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g3ne_ d.144.1.7 (E:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]}
adqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstirevavlrhl
etfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvptetikdmmfq
llrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlwyrap
evllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwprdva
lprqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyfq

SCOPe Domain Coordinates for d1g3ne_:

Click to download the PDB-style file with coordinates for d1g3ne_.
(The format of our PDB-style files is described here.)

Timeline for d1g3ne_: