Lineage for d1g3ne_ (1g3n E:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) 
Family d.144.1.1: Serine/threonin kinases [56113] (15 proteins) Protein Cyclin-dependent PK (CDK, different isozymes) [56114] (1 species) Species Human (Homo sapiens) [TaxId:9606] [56115] (20 PDB entries) 
Domain d1g3ne_: 1g3n E: [41614]
Other proteins in same PDB: d1g3nb_, d1g3nc1, d1g3nc2, d1g3nf_, d1g3ng1, d1g3ng2
Details for d1g3ne_
PDB Entry: 1g3n (more details), 2.9 Å
PDB Description: structure of a p18(ink4c)-cdk6-k-cyclin ternary complex
SCOP Domain Sequences for d1g3ne_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g3ne_ d.144.1.1 (E:) Cyclin-dependent PK (CDK, different isozymes) {Human (Homo sapiens)}
adqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstirevavlrhl
etfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvptetikdmmfq
llrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlwyrap
evllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwprdva
lprqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyfq
SCOP Domain Coordinates for d1g3ne_:
Click to download the PDB-style file with coordinates for d1g3ne_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g3ne_:
- d1g3ne_ appears in SCOP 1.57
- d1g3ne_ appears in the current release, SCOPe 2.08
View in 3D
