SCOPe 2.08: Domain d6im5a1: 6im5 A:211-426

Lineage for d6im5a1 (6im5 A:211-426)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.26: TEAD-like transcription factors, E-set domain [418817] (2 proteins)
   Pfam PF17725

6. Protein Transcription factor TEAD1, YAP-binding domain [419133] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [419655] (4 PDB entries)

8. Domain d6im5a1: 6im5 A:211-426 [416122]
   automated match to d3kysa_
   complexed with po4

Details for d6im5a1

PDB Entry: 6im5, 1.7 Å

PDB Description: yap-binding domain of human tead1

PDB Compounds: (A:) Transcriptional enhancer factor TEF-1

SCOPe Domain Sequences for d6im5a1:

Sequence, based on SEQRES records:

>d6im5a1 b.1.18.26 (A:211-426) Transcription factor TEAD1, YAP-binding domain {Human (Homo sapiens) [TaxId: 9606]}
igttklrlvefsafleqqrdpdsynkhlfvhighanhsysdpllesvdirqiydkfpekk
gglkelfgkgpqnafflvkfwadlncniqddagafygvtsqyessenmtvtcstkvcsfg
kqvvekveteyarfengrfvyrinrspmceyminfihklkhlpekymmnsvlenftillv
vtnrdtqetllcmacvfevsnsehgaqhhiyrlvkd

Sequence, based on observed residues (ATOM records):

>d6im5a1 b.1.18.26 (A:211-426) Transcription factor TEAD1, YAP-binding domain {Human (Homo sapiens) [TaxId: 9606]}
igttklrlvefsafleqqrdpdsynkhlfvhighdpllesvdirqiydkfpekkgglkel
fgkgpqnafflvkfwadlncniqddagafygvtsqyessenmtvtcstkvcsfgkqvvek
veteyarfengrfvyrinrspmceyminfihklkhlpekymmnsvlenftillvvtnrdt
qetllcmacvfevsnsehgaqhhiyrlvkd

Timeline for d6im5a1:

• d6im5a1 is new in SCOPe 2.08-stable