Lineage for d6i5kc1 (6i5k C:148-483)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2984752Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2984753Protein automated matches [190417] (37 species)
    not a true protein
  7. 2984910Species Human (Homo sapiens) [TaxId:9606] [187294] (1476 PDB entries)
  8. 2986341Domain d6i5kc1: 6i5k C:148-483 [416094]
    Other proteins in same PDB: d6i5ka2, d6i5kb2, d6i5kc2
    automated match to d6fyla_
    complexed with gol, h3h, po4

Details for d6i5kc1

PDB Entry: 6i5k (more details), 2.3 Å

PDB Description: crystal structure of clk1 in complexed with furo[3,2-b]pyridine compound vn345 (derivative of compound 12h)
PDB Compounds: (C:) Dual specificity protein kinase CLK1

SCOPe Domain Sequences for d6i5kc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i5kc1 d.144.1.0 (C:148-483) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hlicqsgdvlsaryeivdtlgegafgkvvecidhkaggrhvavkivknvdryceaarsei
qvlehlnttdpnstfrcvqmlewfehhghicivfellglstydfikengflpfrldhirk
mayqicksvnflhsnklthtdlkpenilfvqsdyteaynpkikrdertlinpdikvvdfg
satyddehhstlvstrhyrapevilalgwsqpcdvwsigcilieyylgftvfpthdskeh
lammerilgplpkhmiqktrkrkyfhhdrldwdehssagryvsrackplkefmlsqdveh
erlfdliqkmleydpakritlrealkhpffdllkks

SCOPe Domain Coordinates for d6i5kc1:

Click to download the PDB-style file with coordinates for d6i5kc1.
(The format of our PDB-style files is described here.)

Timeline for d6i5kc1:

  • d6i5kc1 is new in SCOPe 2.08-stable