SCOPe 2.08: Domain d6i5kb1: 6i5k B:148-481

Lineage for d6i5kb1 (6i5k B:148-481)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (1476 PDB entries)

8. Domain d6i5kb1: 6i5k B:148-481 [416092]
   Other proteins in same PDB: d6i5ka2, d6i5kb2, d6i5kc2
   automated match to d6fyla_
   complexed with gol, h3h, po4

Details for d6i5kb1

PDB Entry: 6i5k, 2.3 Å

PDB Description: crystal structure of clk1 in complexed with furo[3,2-b]pyridine compound vn345 (derivative of compound 12h)

PDB Compounds: (B:) Dual specificity protein kinase CLK1

SCOPe Domain Sequences for d6i5kb1:

Sequence; same for both SEQRES and ATOM records:

>d6i5kb1 d.144.1.0 (B:148-481) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hlicqsgdvlsaryeivdtlgegafgkvvecidhkaggrhvavkivknvdryceaarsei
qvlehlnttdpnstfrcvqmlewfehhghicivfellglstydfikengflpfrldhirk
mayqicksvnflhsnklthtdlkpenilfvqsdyteaynpkikrdertlinpdikvvdfg
satyddehhstlvstrhyrapevilalgwsqpcdvwsigcilieyylgftvfpthdskeh
lammerilgplpkhmiqktrkrkyfhhdrldwdehssagryvsrackplkefmlsqdveh
erlfdliqkmleydpakritlrealkhpffdllk

Timeline for d6i5kb1:

• d6i5kb1 is new in SCOPe 2.08-stable