Lineage for d6i57a1 (6i57 A:622-742)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726649Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. 2726989Family a.118.8.0: automated matches [191581] (1 protein)
    not a true family
  6. 2726990Protein automated matches [191037] (12 species)
    not a true protein
  7. 2727017Species Human (Homo sapiens) [TaxId:9606] [255451] (15 PDB entries)
  8. 2727033Domain d6i57a1: 6i57 A:622-742 [416084]
    Other proteins in same PDB: d6i57a2
    automated match to d6zbka_

Details for d6i57a1

PDB Entry: 6i57 (more details)

PDB Description: nmr structure of the third tpr domain of the human spag1 protein
PDB Compounds: (A:) Sperm-associated antigen 1

SCOPe Domain Sequences for d6i57a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i57a1 a.118.8.0 (A:622-742) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tfkalkeegnqcvndknykdalskyseclkinnkecaiytnralcylklcqfeeakqdcd
qalqladgnvkafyrralahkglknyqkslidlnkvilldpsiieakmeleevtrllnlk
d

SCOPe Domain Coordinates for d6i57a1:

Click to download the PDB-style file with coordinates for d6i57a1.
(The format of our PDB-style files is described here.)

Timeline for d6i57a1:

  • d6i57a1 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6i57a2