Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
Protein automated matches [226927] (20 species) not a true protein |
Species Trypanosoma cruzi [TaxId:5693] [420016] (2 PDB entries) |
Domain d6hyqc2: 6hyq C:356-501 [416081] automated match to d6floa2 complexed with act, gmp |
PDB Entry: 6hyq (more details), 2.08 Å
SCOPe Domain Sequences for d6hyqc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hyqc2 b.82.3.0 (C:356-501) automated matches {Trypanosoma cruzi [TaxId: 5693]} iqflanvpflggldsyeklqladalsseefspgeyiihygeegewlyiimegtvevigrd adgeptkvceftqgdhigeleflnnhrtvadvvatthvitaklnrrhfemclgpvidvlk rcaddpkyeyyqnvlktgaaqpsyvd
Timeline for d6hyqc2: