SCOPe 2.08: Domain d6hyqc2: 6hyq C:356-501

Lineage for d6hyqc2 (6hyq C:356-501)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)

Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
one turn of helix is made by two pairs of antiparallel strands linked with short turns
has appearance of a sandwich of distinct architecture and jelly-roll topology

Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)
Family b.82.3.0: automated matches [227198] (1 protein)
not a true family
Protein automated matches [226927] (20 species)
not a true protein
Species Trypanosoma cruzi [TaxId:5693] [420016] (2 PDB entries)
Domain d6hyqc2: 6hyq C:356-501 [416081]
automated match to d6floa2
complexed with act, gmp

Details for d6hyqc2

PDB Entry: 6hyq (more details), 2.08 Å

PDB Description: regulatory subunit of a camp-independent protein kinase a from trypanosoma cruzi bound to guanosine

PDB Compounds: (C:) Protein kinase A regulatory subunit

SCOPe Domain Sequences for d6hyqc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hyqc2 b.82.3.0 (C:356-501) automated matches {Trypanosoma cruzi [TaxId: 5693]}
iqflanvpflggldsyeklqladalsseefspgeyiihygeegewlyiimegtvevigrd
adgeptkvceftqgdhigeleflnnhrtvadvvatthvitaklnrrhfemclgpvidvlk
rcaddpkyeyyqnvlktgaaqpsyvd

SCOPe Domain Coordinates for d6hyqc2:

Click to download the PDB-style file with coordinates for d6hyqc2.
(The format of our PDB-style files is described here.)

Timeline for d6hyqc2: