SCOPe 2.08: Domain d6hnma_: 6hnm A:

Lineage for d6hnma_ (6hnm A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (35 species)
   not a true protein

7. Species Streptomyces antibioticus [TaxId:1890] [376339] (3 PDB entries)

8. Domain d6hnma_: 6hnm A: [416070]
   automated match to d6hnna_

Details for d6hnma_

PDB Entry: 6hnm, 2 Å

PDB Description: crystal structure of idmh 96-104 loop truncation variant

PDB Compounds: (A:) Putative polyketide cyclase IdmH

SCOPe Domain Sequences for d6hnma_:

Sequence; same for both SEQRES and ATOM records:

>d6hnma_ d.17.4.0 (A:) automated matches {Streptomyces antibioticus [TaxId: 1890]}
qpsdtiaglyeafnsgdletlreliapdavihlpgtagdaehppgtprdregwlgvwqft
qaffpdmtatvqdivqtgdlvatrcvargthsgrpfemtmlnmsrvrdgrivehwtisdn
vtmlaqlg

Timeline for d6hnma_:

• d6hnma_ is new in SCOPe 2.08-stable