![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
![]() | Protein automated matches [190205] (35 species) not a true protein |
![]() | Species Streptomyces antibioticus [TaxId:1890] [376339] (3 PDB entries) |
![]() | Domain d6hnma_: 6hnm A: [416070] automated match to d6hnna_ |
PDB Entry: 6hnm (more details), 2 Å
SCOPe Domain Sequences for d6hnma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hnma_ d.17.4.0 (A:) automated matches {Streptomyces antibioticus [TaxId: 1890]} qpsdtiaglyeafnsgdletlreliapdavihlpgtagdaehppgtprdregwlgvwqft qaffpdmtatvqdivqtgdlvatrcvargthsgrpfemtmlnmsrvrdgrivehwtisdn vtmlaqlg
Timeline for d6hnma_: