Lineage for d6hnma_ (6hnm A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2937177Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 2937178Protein automated matches [190205] (35 species)
    not a true protein
  7. 2937325Species Streptomyces antibioticus [TaxId:1890] [376339] (3 PDB entries)
  8. 2937326Domain d6hnma_: 6hnm A: [416070]
    automated match to d6hnna_

Details for d6hnma_

PDB Entry: 6hnm (more details), 2 Å

PDB Description: crystal structure of idmh 96-104 loop truncation variant
PDB Compounds: (A:) Putative polyketide cyclase IdmH

SCOPe Domain Sequences for d6hnma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hnma_ d.17.4.0 (A:) automated matches {Streptomyces antibioticus [TaxId: 1890]}
qpsdtiaglyeafnsgdletlreliapdavihlpgtagdaehppgtprdregwlgvwqft
qaffpdmtatvqdivqtgdlvatrcvargthsgrpfemtmlnmsrvrdgrivehwtisdn
vtmlaqlg

SCOPe Domain Coordinates for d6hnma_:

Click to download the PDB-style file with coordinates for d6hnma_.
(The format of our PDB-style files is described here.)

Timeline for d6hnma_:

  • d6hnma_ is new in SCOPe 2.08-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d6hnmb_