![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.26: TEAD-like transcription factors, E-set domain [418817] (2 proteins) Pfam PF17725 |
![]() | Protein Transcription factor TEAD1, YAP-binding domain [419133] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [419655] (4 PDB entries) |
![]() | Domain d6hild_: 6hil D: [416065] automated match to d3kysa_ complexed with myr; mutant |
PDB Entry: 6hil (more details), 2.3 Å
SCOPe Domain Sequences for d6hild_:
Sequence, based on SEQRES records: (download)
>d6hild_ b.1.18.26 (D:) Transcription factor TEAD1, YAP-binding domain {Human (Homo sapiens) [TaxId: 9606]} igttklrlvefsafleqqrdpdsynkhlfvhighanhsysdpllesvdirqiydkfpekk gglkelfgkgpqnafflvkfwadlncniqddagafygvtsqyessenmtvtcstkvcsfg kqvvekveteyarfengrfvyrinrspmceyminfihklkhlpekymmnsvlenftillv vtnrdtqetllcmacvfevsnsehgaqhhihrlvk
>d6hild_ b.1.18.26 (D:) Transcription factor TEAD1, YAP-binding domain {Human (Homo sapiens) [TaxId: 9606]} igttklrlvefsafleqqrdpdsynkhlfvhigllesvdirqiydkfpekkgglkelfgk gpqnafflvkfwadlncniagafygvtsqyessenmtvtcstkvcsfgkqvvekveteya rfengrfvyrinrspmceyminfihklkhlpekymmnsvlenftillvvtnrdtqetllc macvfevsnsehgaqhhihrlvk
Timeline for d6hild_: