SCOPe 2.08: Domain d6hilb_: 6hil B:

Lineage for d6hilb_ (6hil B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.26: TEAD-like transcription factors, E-set domain [418817] (2 proteins)
   Pfam PF17725

6. Protein Transcription factor TEAD1, YAP-binding domain [419133] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [419655] (4 PDB entries)

8. Domain d6hilb_: 6hil B: [416063]
   automated match to d3kysa_
   complexed with myr; mutant

Details for d6hilb_

PDB Entry: 6hil, 2.3 Å

PDB Description: x-ray structure of tead1(y421h mutant) complexed with yap(wildtype): molecular and structural characterization of a tead mutation at the origin of sveinsson's chorioretinal atrophy

PDB Compounds: (B:) Transcriptional enhancer factor TEF-1

SCOPe Domain Sequences for d6hilb_:

Sequence, based on SEQRES records:

>d6hilb_ b.1.18.26 (B:) Transcription factor TEAD1, YAP-binding domain {Human (Homo sapiens) [TaxId: 9606]}
igttklrlvefsafleqqrdpdsynkhlfvhighanhsysdpllesvdirqiydkfpekk
gglkelfgkgpqnafflvkfwadlncniqddagafygvtsqyessenmtvtcstkvcsfg
kqvvekveteyarfengrfvyrinrspmceyminfihklkhlpekymmnsvlenftillv
vtnrdtqetllcmacvfevsnsehgaqhhihrlvk

Sequence, based on observed residues (ATOM records):

>d6hilb_ b.1.18.26 (B:) Transcription factor TEAD1, YAP-binding domain {Human (Homo sapiens) [TaxId: 9606]}
igttklrlvefsafleqqrdpdsynkhlfvhigllesvdirqiydkfpekkgglkelfgk
gpqnafflvkfwadlncniagafygvtsqyessenmtvtcstkvcsfgkqvvekveteya
rfengrfvyrinrspmceyminfihklkhlpekymmnsvlenftillvvtnrdtqetllc
macvfevsnsehgaqhhihrlvk

Timeline for d6hilb_:

• d6hilb_ is new in SCOPe 2.08-stable