Lineage for d6hila_ (6hil A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766067Family b.1.18.26: TEAD-like transcription factors, E-set domain [418817] (2 proteins)
    Pfam PF17725
  6. 2766068Protein Transcription factor TEAD1, YAP-binding domain [419133] (1 species)
  7. 2766069Species Human (Homo sapiens) [TaxId:9606] [419655] (4 PDB entries)
  8. 2766074Domain d6hila_: 6hil A: [416062]
    automated match to d3kysa_
    complexed with myr; mutant

Details for d6hila_

PDB Entry: 6hil (more details), 2.3 Å

PDB Description: x-ray structure of tead1(y421h mutant) complexed with yap(wildtype): molecular and structural characterization of a tead mutation at the origin of sveinsson's chorioretinal atrophy
PDB Compounds: (A:) Transcriptional enhancer factor TEF-1

SCOPe Domain Sequences for d6hila_:

Sequence, based on SEQRES records: (download)

>d6hila_ b.1.18.26 (A:) Transcription factor TEAD1, YAP-binding domain {Human (Homo sapiens) [TaxId: 9606]}
igttklrlvefsafleqqrdpdsynkhlfvhighanhsysdpllesvdirqiydkfpekk
gglkelfgkgpqnafflvkfwadlncniqddagafygvtsqyessenmtvtcstkvcsfg
kqvvekveteyarfengrfvyrinrspmceyminfihklkhlpekymmnsvlenftillv
vtnrdtqetllcmacvfevsnsehgaqhhihrlvk

Sequence, based on observed residues (ATOM records): (download)

>d6hila_ b.1.18.26 (A:) Transcription factor TEAD1, YAP-binding domain {Human (Homo sapiens) [TaxId: 9606]}
igttklrlvefsafleqqrdpdsynkhlfvhiglesvdirqiydkfpekkgglkelfgkg
pqnafflvkfwadlncniagafygvtsqyessenmtvtcstkvcsfgkqvvekveteyar
fengrfvyrinrspmceyminfihklkhlpekymmnsvlenftillvvtnrdtqetllcm
acvfevsnsehgaqhhihrlvk

SCOPe Domain Coordinates for d6hila_:

Click to download the PDB-style file with coordinates for d6hila_.
(The format of our PDB-style files is described here.)

Timeline for d6hila_:

  • d6hila_ is new in SCOPe 2.08-stable