Lineage for d1qmzc_ (1qmz C:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 262793Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 262794Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 262795Family d.144.1.1: Serine/threonin kinases [56113] (21 proteins)
  6. 262839Protein Cyclin-dependent PK (CDK, different isozymes) [56114] (1 species)
  7. 262840Species Human (Homo sapiens) [TaxId:9606] [56115] (47 PDB entries)
  8. 262872Domain d1qmzc_: 1qmz C: [41605]
    Other proteins in same PDB: d1qmzb1, d1qmzb2, d1qmzd1, d1qmzd2

Details for d1qmzc_

PDB Entry: 1qmz (more details), 2.2 Å

PDB Description: phosphorylated cdk2-cyclyin a-substrate peptide complex

SCOP Domain Sequences for d1qmzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qmzc_ d.144.1.1 (C:) Cyclin-dependent PK (CDK, different isozymes) {Human (Homo sapiens)}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl

SCOP Domain Coordinates for d1qmzc_:

Click to download the PDB-style file with coordinates for d1qmzc_.
(The format of our PDB-style files is described here.)

Timeline for d1qmzc_: