Lineage for d6gw8a_ (6gw8 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037738Fold g.46: Metallothionein [57867] (1 superfamily)
    metal(iron)-bound fold
    duplication: consists of clear structural/sequence repeats
  4. 3037739Superfamily g.46.1: Metallothionein [57868] (2 families) (S)
  5. 3037782Family g.46.1.0: automated matches [357866] (1 protein)
    not a true family
  6. 3037783Protein automated matches [357867] (1 species)
    not a true protein
  7. 3037784Species Pseudomonas fluorescens [TaxId:1038922] [357868] (3 PDB entries)
  8. 3037785Domain d6gw8a_: 6gw8 A: [416036]
    automated match to d6gv7a_
    complexed with zn

Details for d6gw8a_

PDB Entry: 6gw8 (more details)

PDB Description: zn(ii) form of shortened metallothionein from pseudomonas fluorescens q2-87 (residues 1-52)
PDB Compounds: (A:) metallothionein

SCOPe Domain Sequences for d6gw8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gw8a_ g.46.1.0 (A:) automated matches {Pseudomonas fluorescens [TaxId: 1038922]}
nelrcgcpdchckvdpervfnhdgeaycsqacaeqhpngepcpapdchcers

SCOPe Domain Coordinates for d6gw8a_:

Click to download the PDB-style file with coordinates for d6gw8a_.
(The format of our PDB-style files is described here.)

Timeline for d6gw8a_:

  • d6gw8a_ is new in SCOPe 2.08-stable