![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.46: Metallothionein [57867] (1 superfamily) metal(iron)-bound fold duplication: consists of clear structural/sequence repeats |
![]() | Superfamily g.46.1: Metallothionein [57868] (2 families) ![]() |
![]() | Family g.46.1.0: automated matches [357866] (1 protein) not a true family |
![]() | Protein automated matches [357867] (1 species) not a true protein |
![]() | Species Pseudomonas fluorescens [TaxId:1038922] [357868] (3 PDB entries) |
![]() | Domain d6gw8a_: 6gw8 A: [416036] automated match to d6gv7a_ complexed with zn |
PDB Entry: 6gw8 (more details)
SCOPe Domain Sequences for d6gw8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gw8a_ g.46.1.0 (A:) automated matches {Pseudomonas fluorescens [TaxId: 1038922]} nelrcgcpdchckvdpervfnhdgeaycsqacaeqhpngepcpapdchcers
Timeline for d6gw8a_: