Lineage for d6gixd_ (6gix D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792430Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2792578Family b.42.4.0: automated matches [191368] (1 protein)
    not a true family
  6. 2792579Protein automated matches [190445] (12 species)
    not a true protein
  7. 2792637Species Lepidium virginicum [TaxId:59292] [419804] (4 PDB entries)
  8. 2792648Domain d6gixd_: 6gix D: [416023]
    automated match to d6s2za_
    complexed with chl; mutant

Details for d6gixd_

PDB Entry: 6gix (more details), 2.8 Å

PDB Description: water-soluble chlorophyll protein (wscp) from lepidium virginicum (mutation l91p) with chlorophyll-b
PDB Compounds: (D:) Water-soluble chlorophyll protein

SCOPe Domain Sequences for d6gixd_:

Sequence, based on SEQRES records: (download)

>d6gixd_ b.42.4.0 (D:) automated matches {Lepidium virginicum [TaxId: 59292]}
epvkdtngnplkietryfiqpasdnnggglvpanvdlshlcplgivrtslpyqpglpvti
stpsssegndvltntniaitfdapiwpcpssktwtvdssseekyiitggdpksgesffri
ekygngkntyklvrydngegksvgstkslwgpalvlnddddsdenafpikfrevd

Sequence, based on observed residues (ATOM records): (download)

>d6gixd_ b.42.4.0 (D:) automated matches {Lepidium virginicum [TaxId: 59292]}
epvkdtngnplkietryfiqpasggglvpanvdlshlcplgivrtslpyqpglpvtistp
ndvltntniaitfdapiwpcpssktwtvdssseekyiitggdpksgesffriekygngkn
tyklvrygksvgstkslwgpalvlnddddsdenafpikfrevd

SCOPe Domain Coordinates for d6gixd_:

Click to download the PDB-style file with coordinates for d6gixd_.
(The format of our PDB-style files is described here.)

Timeline for d6gixd_:

  • d6gixd_ is new in SCOPe 2.08-stable