Class b: All beta proteins [48724] (180 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.4: STI-like [50386] (3 families) |
Family b.42.4.0: automated matches [191368] (1 protein) not a true family |
Protein automated matches [190445] (12 species) not a true protein |
Species Lepidium virginicum [TaxId:59292] [419804] (4 PDB entries) |
Domain d6giwc_: 6giw C: [416018] automated match to d6s2za_ complexed with cla; mutant |
PDB Entry: 6giw (more details), 2.8 Å
SCOPe Domain Sequences for d6giwc_:
Sequence, based on SEQRES records: (download)
>d6giwc_ b.42.4.0 (C:) automated matches {Lepidium virginicum [TaxId: 59292]} epvkdtngnplkietryfiqpasdnnggglvpanvdlshlcplgivrtslpyqpglpvti stpsssegndvltntniaitfdapiwpcpssktwtvdssseekyiitggdpksgesffri ekygngkntyklvrydngegksvgstkslwgpalvlnddddsdenafpikfrevd
>d6giwc_ b.42.4.0 (C:) automated matches {Lepidium virginicum [TaxId: 59292]} epvkdtngnplkietryfiqpasggglvpanvdlshlcplgivrtslpyqpglpvtistp ndvltntniaitfdapiwpcpssktwtvdssseekyiitggdpksgesffriekygngkn tyklvrygksvgstkslwgpalvlndnafpikfrevd
Timeline for d6giwc_: