Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.1: Serine/threonin kinases [56113] (21 proteins) |
Protein Cyclin-dependent PK (CDK, different isozymes) [56114] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [56115] (47 PDB entries) |
Domain d1di8a_: 1di8 A: [41601] complexed with dtq |
PDB Entry: 1di8 (more details), 2.2 Å
SCOP Domain Sequences for d1di8a_:
Sequence, based on SEQRES records: (download)
>d1di8a_ d.144.1.1 (A:) Cyclin-dependent PK (CDK, different isozymes) {Human (Homo sapiens)} menfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh pnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchs hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlrl
>d1di8a_ d.144.1.1 (A:) Cyclin-dependent PK (CDK, different isozymes) {Human (Homo sapiens)} menfqkvekigegtygvvykarnkltgevvalkkirgvpstaireisllkelnhpnivkl ldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchshrvlhr dlkpqnllintegaikladfglarafevvtlwyrapeillgckyystavdiwslgcifae mvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsfpkwarqdfskvvppl dedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlrl
Timeline for d1di8a_: