Lineage for d6ge4a_ (6ge4 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766067Family b.1.18.26: TEAD-like transcription factors, E-set domain [418817] (2 proteins)
    Pfam PF17725
  6. 2766080Protein automated matches [419244] (2 species)
    not a true protein
  7. 2766081Species Human (Homo sapiens) [TaxId:9606] [419859] (24 PDB entries)
  8. 2766096Domain d6ge4a_: 6ge4 A: [415994]
    automated match to d3kysa_
    complexed with myr

Details for d6ge4a_

PDB Entry: 6ge4 (more details), 1.97 Å

PDB Description: tead4 (216-434);e263a complexed with yap peptide (60-100) and myristoate (covalently bound) at 1.97a (p41212 crystal form); myristoylation was done by adding myr-coa
PDB Compounds: (A:) Transcriptional enhancer factor TEF-3

SCOPe Domain Sequences for d6ge4a_:

Sequence, based on SEQRES records: (download)

>d6ge4a_ b.1.18.26 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsvassklwmlefsafleqqqdpdtynkhlfvhigqsspsysdpylaavdirqiydkfpe
kkgglkdlfergpsnafflvkfwadlntniedegssfygvssqyespenmiitcstkvcs
fgkqvvekveteyaryenghysyrihrsplceyminfihklkhlpekymmnsvlenftil
qvvtnrdtqetllciayvfevsasehgaqhhiyrlvke

Sequence, based on observed residues (ATOM records): (download)

>d6ge4a_ b.1.18.26 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsvassklwmlefsafleqqqdpdtynkhlfvhigdpylaavdirqiydkfpekkgglkd
lfergpsnafflvkfwadlntnigssfygvssqyespenmiitcstkvcsfgkqvvekve
teyaryenghysyrihrsplceyminfihklkhlpekymmnsvlenftilqvvtnrdtqe
tllciayvfevsasehgaqhhiyrlvke

SCOPe Domain Coordinates for d6ge4a_:

Click to download the PDB-style file with coordinates for d6ge4a_.
(The format of our PDB-style files is described here.)

Timeline for d6ge4a_:

  • d6ge4a_ is new in SCOPe 2.08-stable