SCOPe 2.08: Domain d6ge3a_: 6ge3 A:

Lineage for d6ge3a_ (6ge3 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.26: TEAD-like transcription factors, E-set domain [418817] (2 proteins)
   Pfam PF17725

6. Protein automated matches [419244] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [419859] (24 PDB entries)

8. Domain d6ge3a_: 6ge3 A: [415993]
   automated match to d3kysa_
   complexed with gol, myr; mutant

Details for d6ge3a_

PDB Entry: 6ge3, 1.85 Å

PDB Description: x-ray structure of tead4 (wildtype) complexed with yap (wildtype): the role of residual flexibility and water molecules in the adaptation of a bound intrinsically disordered protein to mutations at a binding interface

PDB Compounds: (A:) Transcriptional enhancer factor TEF-3

SCOPe Domain Sequences for d6ge3a_:

Sequence, based on SEQRES records:

>d6ge3a_ b.1.18.26 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsvassklwmlefsafleqqqdpdtynkhlfvhigqsspsysdpyleavdirqiydkfpe
kkgglkdlfergpsnafflvkfwadlntniedegssfygvssqyespenmiitcstkvcs
fgkqvvekveteyaryenghysyrihrsplceyminfihklkhlpekymmnsvlenftil
qvvtnrdtqetllciayvfevsasehgaqhhiyrlvke

Sequence, based on observed residues (ATOM records):

>d6ge3a_ b.1.18.26 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsvassklwmlefsafleqqqdpdtynkhlfvhigleavdirqiydkfpekkgglkdlfe
rgpsnafflvkfwadlntngssfygvssqyespenmiitcstkvcsfgkqvvekveteya
ryenghysyrihrsplceyminfihklkhlpekymmnsvlenftilqvvtnrdtqetllc
iayvfevsasehgaqhhiyrlvke

Timeline for d6ge3a_:

• d6ge3a_ is new in SCOPe 2.08-stable