Lineage for d6gc2l_ (6gc2 L:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758340Domain d6gc2l_: 6gc2 L: [415992]
    Other proteins in same PDB: d6gc2h2
    automated match to d6shgl_

Details for d6gc2l_

PDB Entry: 6gc2 (more details), 2.55 Å

PDB Description: ablift: antibody stability and affinity optimization by computational design of the variable light-heavy chain interface
PDB Compounds: (L:) light chain

SCOPe Domain Sequences for d6gc2l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gc2l_ b.1.1.0 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dieltqspatlsvtpgdsvslscrasqsisnnlhwyqqkshepprllikyvsqsvsgips
rfsgsgsgtdftlsinsvetedfgmyfcgqsnswprtfgggtkleikrtvaapsvfifpp
sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
lskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d6gc2l_:

Click to download the PDB-style file with coordinates for d6gc2l_.
(The format of our PDB-style files is described here.)

Timeline for d6gc2l_:

  • d6gc2l_ is new in SCOPe 2.08-stable