Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.64: Filovirus surface glycoprotein-like [418716] (1 superfamily) pre-fusion conformation with complex fold including several alpha+beta domains |
Superfamily f.64.1: Filovirus surface glycoprotein-like [418747] (1 family) |
Family f.64.1.1: Filovirus surface glycoproteins [418806] (1 protein) |
Protein Ebolavirus surface glycoprotein [419113] (2 species) |
Species Zaire Ebola virus (strain mayinga-76) [419631] (5 PDB entries) |
Domain d6g9ba1: 6g9b A:32-477 [415986] Other proteins in same PDB: d6g9ba2 automated match to d3csyi_ complexed with dms, gol, ixx, nag |
PDB Entry: 6g9b (more details), 2.26 Å
SCOPe Domain Sequences for d6g9ba1:
Sequence, based on SEQRES records: (download)
>d6g9ba1 f.64.1.1 (A:32-477) Ebolavirus surface glycoprotein {Zaire Ebola virus (strain mayinga-76)} siplgvihnsalqvsdvdklvcrdklsstnqlrsvglnlegngvatdvpsatkrwgfrsg vppkvvnyeagewaencynleikkpdgseclpaapdgirgfprcryvhkvsgtgpcagdf afhkegafflydrlastviyrgttfaegvvaflilpqakkdffsshplrepvnatedpss gyysttiryqatgfgtneteylfevdnltyvqlesrftpqfllqlnetiytsgkrsnttg kliwkvnpeidttigewafwetkknltrkirseelsftvvsxxxxxxx
>d6g9ba1 f.64.1.1 (A:32-477) Ebolavirus surface glycoprotein {Zaire Ebola virus (strain mayinga-76)} siplgvihnsalqvsdvdklvcrdklsstnqlrsvglnlegngvatdvpsatkrwgfrsg vppkvvnyeagewaencynleikkpdgseclpaapdgirgfprcryvhkvsgtgpcagdf afhkegafflydrlastviyrgttfaegvvaflilpqasgyysttiryqatgfgtnetey lfevdnltyvqlesrftpqfllqlnetiytsgkrsnttgkliwkvnpeidttwafwetls ftvvsxxxxxxx
Timeline for d6g9ba1: