SCOPe 2.08: Domain d6g33c1: 6g33 C:148-482

Lineage for d6g33c1 (6g33 C:148-482)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (1476 PDB entries)

8. Domain d6g33c1: 6g33 C:148-482 [415982]
   Other proteins in same PDB: d6g33a2, d6g33b2, d6g33c2
   automated match to d6fyla_
   complexed with 5id, iod, po4

Details for d6g33c1

PDB Entry: 6g33, 2.05 Å

PDB Description: crystal structure of clk1 in complex with 5-iodotubercidin

PDB Compounds: (C:) Dual specificity protein kinase CLK1

SCOPe Domain Sequences for d6g33c1:

Sequence; same for both SEQRES and ATOM records:

>d6g33c1 d.144.1.0 (C:148-482) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hlicqsgdvlsaryeivdtlgegafgkvvecidhkaggrhvavkivknvdryceaarsei
qvlehlnttdpnstfrcvqmlewfehhghicivfellglstydfikengflpfrldhirk
mayqicksvnflhsnklthtdlkpenilfvqsdyteaynpkikrdertlinpdikvvdfg
satyddehhstlvstrhyrapevilalgwsqpcdvwsigcilieyylgftvfpthdskeh
lammerilgplpkhmiqktrkrkyfhhdrldwdehssagryvsrackplkefmlsqdveh
erlfdliqkmleydpakritlrealkhpffdllkk

Timeline for d6g33c1:

• d6g33c1 is new in SCOPe 2.08-stable