Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (37 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187294] (1476 PDB entries) |
Domain d6g33a1: 6g33 A:148-482 [415978] Other proteins in same PDB: d6g33a2, d6g33b2, d6g33c2 automated match to d6fyla_ complexed with 5id, iod, po4 |
PDB Entry: 6g33 (more details), 2.05 Å
SCOPe Domain Sequences for d6g33a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6g33a1 d.144.1.0 (A:148-482) automated matches {Human (Homo sapiens) [TaxId: 9606]} hlicqsgdvlsaryeivdtlgegafgkvvecidhkaggrhvavkivknvdryceaarsei qvlehlnttdpnstfrcvqmlewfehhghicivfellglstydfikengflpfrldhirk mayqicksvnflhsnklthtdlkpenilfvqsdyteaynpkikrdertlinpdikvvdfg satyddehhstlvstrhyrapevilalgwsqpcdvwsigcilieyylgftvfpthdskeh lammerilgplpkhmiqktrkrkyfhhdrldwdehssagryvsrackplkefmlsqdveh erlfdliqkmleydpakritlrealkhpffdllkk
Timeline for d6g33a1:
View in 3D Domains from other chains: (mouse over for more information) d6g33b1, d6g33b2, d6g33c1, d6g33c2 |