Lineage for d6fypa_ (6fyp A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2984752Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2984753Protein automated matches [190417] (37 species)
    not a true protein
  7. 2984910Species Human (Homo sapiens) [TaxId:9606] [187294] (1476 PDB entries)
  8. 2986415Domain d6fypa_: 6fyp A: [415975]
    automated match to d6fyka_
    complexed with 3ng

Details for d6fypa_

PDB Entry: 6fyp (more details), 2.29 Å

PDB Description: x-ray structure of clk3-kd(gp-[275-632], non-phos.)/cx-4945 at 2.29a
PDB Compounds: (A:) Dual specificity protein kinase CLK3

SCOPe Domain Sequences for d6fypa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fypa_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sveddkeghlvcrigdwlqeryeivgnlgegtfgkvvecldhargksqvalkiirnvgky
reaarleinvlkkikekdkenkflcvlmsdwfnfhghmciafellgkntfeflkennfqp
yplphvrhmayqlchalrflhenqlthtdlkpenilfvnsefetlynehksceeksvknt
sirvadfgsatfdhehhttivatrhyrppevilelgwaqpcdvwsigcilfeyyrgftlf
qthenrehlvmmekilgpipshmihrtrkqkyfykgglvwdenssdgryvkenckplksy
mlqdslehvqlfdlmrrmlefdpaqritlaeallhpffagltpeersf

SCOPe Domain Coordinates for d6fypa_:

Click to download the PDB-style file with coordinates for d6fypa_.
(The format of our PDB-style files is described here.)

Timeline for d6fypa_:

  • d6fypa_ is new in SCOPe 2.08-stable