SCOPe 2.06: Domain d1blxa_: 1blx A:

Lineage for d1blxa_ (1blx A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cyclin-dependent PK, CDK6 [88859] (1 species)
   CMGC group; CDKs subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [88860] (14 PDB entries)

8. Domain d1blxa_: 1blx A: [41596]
   Other proteins in same PDB: d1blxb_
   complexed with ca

Details for d1blxa_

PDB Entry: 1blx, 1.9 Å

PDB Description: p19ink4d/cdk6 complex

PDB Compounds: (A:) cyclin-dependent kinase 6

SCOPe Domain Sequences for d1blxa_:

Sequence; same for both SEQRES and ATOM records:

>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]}
glcradqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstirevav
lrhletfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvptetikd
mmfqllrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlw
yrapevllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwp
rdvalprqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyfqdle
rcken

Timeline for d1blxa_:

• d1blxa_ first appeared (with stable ids) in SCOP 1.55
  
• d1blxa_ appears in SCOPe 2.05
  
• d1blxa_ appears in SCOPe 2.07
  
• d1blxa_ appears in the current release, SCOPe 2.08