SCOPe 2.08: Domain d6ft8a1: 6ft8 A:148-483

Lineage for d6ft8a1 (6ft8 A:148-483)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (1476 PDB entries)

8. Domain d6ft8a1: 6ft8 A:148-483 [415955]
   Other proteins in same PDB: d6ft8a2
   automated match to d6fyla_
   complexed with cl, e6t, edo, na

Details for d6ft8a1

PDB Entry: 6ft8, 1.45 Å

PDB Description: crystal structure of clk1 in complex with inhibitor 8g

PDB Compounds: (A:) Dual specificity protein kinase CLK1

SCOPe Domain Sequences for d6ft8a1:

Sequence; same for both SEQRES and ATOM records:

>d6ft8a1 d.144.1.0 (A:148-483) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hlicqsgdvlsaryeivdtlgegafgkvvecidhkaggrhvavkivknvdryceaarsei
qvlehlnttdpnstfrcvqmlewfehhghicivfellglstydfikengflpfrldhirk
mayqicksvnflhsnklthtdlkpenilfvqsdyteaynpkikrdertlinpdikvvdfg
satyddehhstlvstrhyrapevilalgwsqpcdvwsigcilieyylgftvfpthdskeh
lammerilgplpkhmiqktrkrkyfhhdrldwdehssagryvsrackplkefmlsqdveh
erlfdliqkmleydpakritlrealkhpffdllkks

Timeline for d6ft8a1:

• d6ft8a1 is new in SCOPe 2.08-stable