SCOPe 2.08: Domain d6fa3e1: 6fa3 E:1-168

Lineage for d6fa3e1 (6fa3 E:1-168)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)

8. Domain d6fa3e1: 6fa3 E:1-168 [415934]
   Other proteins in same PDB: d6fa3a2, d6fa3b2, d6fa3c2, d6fa3d2, d6fa3e2, d6fa3f2
   automated match to d6mqnb_
   complexed with d1z, dms, gnp, mg

Details for d6fa3e1

PDB Entry: 6fa3, 1.82 Å

PDB Description: antibody derived (abd-6) small molecule binding to kras.

PDB Compounds: (E:) GTPase KRas

SCOPe Domain Sequences for d6fa3e1:

Sequence, based on SEQRES records:

>d6fa3e1 c.37.1.8 (E:1-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
heeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke

Sequence, based on observed residues (ATOM records):

>d6fa3e1 c.37.1.8 (E:1-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
herdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrtv
dtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke

Timeline for d6fa3e1:

• d6fa3e1 is new in SCOPe 2.08-stable